Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF3A Peptide - middle region

GTF3A Peptide - middle region

Product Specifications

Product Name Alternative

AP2, TFIIIA

UniProt

Q92664

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002088.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HILTHTGEKPFVCAANGCDQKFNTKSNLKKHFERKHENQQKQYICSFEDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5-Difluorobenzoic Acid
TRC-D451183-25G 25 g

2,5-Difluorobenzoic Acid

Sign In for Pricing
View Details
Frozen Tissue Blocks, Brain
CB645100 1 Block

Frozen Tissue Blocks, Brain

Sign In for Pricing
View Details
Di-N-butyl Amidosulfenyl Chloride-d18
TRC-D429442-1MG 1 mg

Di-N-butyl Amidosulfenyl Chloride-d18

Sign In for Pricing
View Details
Carbamic Acid Propyl Ester
TRC-C175785-25MG 25 mg

Carbamic Acid Propyl Ester

Sign In for Pricing
View Details
Alpha-Synuclein Recombinant Rabbit Monoclonal Antibody [JB42-33]
ET7107-31 100 µL

Alpha-Synuclein Recombinant Rabbit Monoclonal Antibody [JB42-33]

Sign In for Pricing
View Details
LRIT3 Human Gene Knockout Kit (CRISPR)
KN422748 1 Kit

LRIT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details