Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF3A Peptide - middle region

GTF3A Peptide - middle region

Product Specifications

Product Name Alternative

AP2, TFIIIA

UniProt

Q92664

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002088.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HILTHTGEKPFVCAANGCDQKFNTKSNLKKHFERKHENQQKQYICSFEDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trehalase Microplate Assay Kit
RDSM015 100 Assays

Trehalase Microplate Assay Kit

Sign In for Pricing
View Details
COG3 Human Gene Knockout Kit (CRISPR)
KN211749LP 1 Kit

COG3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS623145 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Involucrin (SY5), CF594 conjugate, 0.1mg/mL
BNC940678-500 1x 500 µL

Involucrin (SY5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC9A2 (NM_003048) Human Over-expression Lysate
LY401065 100 µg

SLC9A2 (NM_003048) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR6 (NM_018031) Human Over-expression Lysate
LC432420 20 µg

WDR6 (NM_018031) Human Over-expression Lysate

Sign In for Pricing
View Details