NECAP2 Peptide - C-terminal region
NECAP2 Peptide - C-terminal region
Product Specifications
UniProt
Q9NVZ3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001138749.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10342181 96 Well
Guinea Pig C X C motif chemokine 2 (CXCL2) ELISA Kit
Sign In for Pricing
View Details 
abx495301-01 96 Tests
Human Translocation Associated Notch Homolog 1 (NOTCH1) CLIA Kit
Sign In for Pricing
View Details abx495301-02 5x 96 Tests
Human Translocation Associated Notch Homolog 1 (NOTCH1) CLIA Kit
Sign In for Pricing
View Details abx495301-03 10x 96 Tests
Human Translocation Associated Notch Homolog 1 (NOTCH1) CLIA Kit
Sign In for Pricing
View Details 
abx230971 100 µg
BTB/POZ Domain-Containing Protein 1 (BTBD1) Antibody
Sign In for Pricing
View Details 