NT5DC2 Peptide - middle region

Product Specifications

UniProt

Q9H857

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001127703.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVGPDWRQLFDVVIVQADKPSFFTDRRKPFRKLDEKGSLQWDRITRLEKG

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELI-21953m 96 Tests

Mouse p53 apoptosis effector related to PMP-22, Perp ELISA KIT

View Details

OR6775 1 Each

3-Benzyloxyphenylhydrazine hydrochloride

View Details

NBP3-06185AF350 0.1 mL

Rabbit Polyclonal ANKH Antibody [Alexa Fluor 350]

View Details

OAAF00916-100UG 100 µg

INPP5D Antibody

View Details

HK300316 200 Reactions

MIR339 Human qPCR Template Standard (MI0000815)

View Details

abx312601-01 20 µg

Transcriptional Regulator ATRX (ATRX) Antibody

View Details