NT5DC2 Peptide - middle region
NT5DC2 Peptide - middle region
Product Specifications
UniProt
Q9H857
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001127703.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MVGPDWRQLFDVVIVQADKPSFFTDRRKPFRKLDEKGSLQWDRITRLEKG
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY421272 100 µg
CD272 (BTLA) (NM_001085357) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRV-0038866-01 24 Tests
ELISA Kit for Protein Kinase B Alpha (PKBa)
Sign In for Pricing
View Details TRV-0038866-02 48 Tests
ELISA Kit for Protein Kinase B Alpha (PKBa)
Sign In for Pricing
View Details TRV-0038866-03 96 Tests
ELISA Kit for Protein Kinase B Alpha (PKBa)
Sign In for Pricing
View Details