Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP43 Peptide - middle region

NUP43 Peptide - middle region

Product Specifications

Product Name Alternative

P42, bA350J20.1

UniProt

Q8NFH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_942590.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCR Plates
P9602-N-T 50 Units/Pack

PCR Plates

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF640R conjugate, 0.1mg/mL
BNC402807-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Air Cooled Chiller BCHI-118
BCHI-118 Each

Air Cooled Chiller BCHI-118

Sign In for Pricing
View Details
RBM4B Human Gene Knockout Kit (CRISPR)
KN402569 1 Kit

RBM4B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kallikrein 14 (KLK14) activation kit by CRISPRa
GA109406 1 Kit

Human Kallikrein 14 (KLK14) activation kit by CRISPRa

Sign In for Pricing
View Details
Cdk9 Recombinant Rabbit Monoclonal Antibody [SD204-07]
ET1612-78 100 µL

Cdk9 Recombinant Rabbit Monoclonal Antibody [SD204-07]

Sign In for Pricing
View Details