Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP43 Peptide - middle region

NUP43 Peptide - middle region

Product Specifications

Product Name Alternative

P42, bA350J20.1

UniProt

Q8NFH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_942590.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTK7 Antibody
KC-7427-01 50 μL

PTK7 Antibody

Sign In for Pricing
View Details
PTK7 Antibody
KC-7427-02 100 µL

PTK7 Antibody

Sign In for Pricing
View Details
PTK7 Antibody
KC-7427-03 1 mL

PTK7 Antibody

Sign In for Pricing
View Details
Glyco-beta-muricholic Acid
TRC-G548670-50MG 50 mg

Glyco-beta-muricholic Acid

Sign In for Pricing
View Details
Psp124BI, 25 preps
FDRE1312 25 Preparations

Psp124BI, 25 preps

Sign In for Pricing
View Details
CD32 (Fc Gamma RIIa) (FCGR2A/479), CF405S conjugate, 0.1mg/mL
BNC040479-500 1x 500 µL

CD32 (Fc Gamma RIIa) (FCGR2A/479), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details