Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM164 Peptide - N-terminal region

TMEM164 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BB360B22.3

UniProt

Q5U3C3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060168.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXD13 (NM_000523) Human Over-expression Lysate
LY424664 100 µg

HOXD13 (NM_000523) Human Over-expression Lysate

Sign In for Pricing
View Details
CAMKK2 Human Gene Knockout Kit (CRISPR)
KN203468BN 1 Kit

CAMKK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DL-Malic Acid-2,3,3-d3
TRC-M159513-5MG 5 mg

DL-Malic Acid-2,3,3-d3

Sign In for Pricing
View Details
VWC2L (NM_001080500) Human Over-expression Lysate
LC421055 20 µg

VWC2L (NM_001080500) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL
BNC741118-500 1x 500 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP4 Mouse Monoclonal Antibody [Clone ID: SB30c]
AM08201PU-N 100 µg

TIMP4 Mouse Monoclonal Antibody [Clone ID: SB30c]

Sign In for Pricing
View Details