Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM164 Peptide - N-terminal region

TMEM164 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BB360B22.3

UniProt

Q5U3C3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060168.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) Goat Polyclonal Antibody
AP31430PU-N 50 µg

Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Sodium 1-Heptanesulfonate
TRC-S634150-25G 25 g

Sodium 1-Heptanesulfonate

Sign In for Pricing
View Details
Optineurin (OPTN) (NM_001008213) Human Over-expression Lysate
LC423392 20 µg

Optineurin (OPTN) (NM_001008213) Human Over-expression Lysate

Sign In for Pricing
View Details
MGP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C9]
TA806404AM 100 µL

MGP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9C9]

Sign In for Pricing
View Details
PAX7 (Center) Rabbit Polyclonal Antibody
AP53181PU-N 400 µL

PAX7 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEF1E1 Rabbit Polyclonal Antibody
TA362186 100 µL

EEF1E1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details