Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSL Peptide - middle region

CTSL Peptide - middle region

Product Specifications

Product Name Alternative

MEP, CATL, CTSL1

UniProt

P07711

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001244900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD2 Antibody
OC-759-01 50 μL

GAD2 Antibody

Sign In for Pricing
View Details
GAD2 Antibody
OC-759-02 100 µL

GAD2 Antibody

Sign In for Pricing
View Details
GAD2 Antibody
OC-759-03 1 mL

GAD2 Antibody

Sign In for Pricing
View Details
Thap4 Mouse Gene Knockout Kit (CRISPR)
KN517514 1 Kit

Thap4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TBC1D1 (NM_015173) Human Recombinant Protein
TP307980L 1 mg

TBC1D1 (NM_015173) Human Recombinant Protein

Sign In for Pricing
View Details
VAC14 (NM_018052) Human Recombinant Protein
TP314195M 100 µg

VAC14 (NM_018052) Human Recombinant Protein

Sign In for Pricing
View Details