Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECI2 Peptide - middle region

ECI2 Peptide - middle region

Product Specifications

Product Name Alternative

DRS1, PECI, ACBD2, DRS-1, HCA88, dJ1013A10.3

UniProt

O75521

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159482.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fascin (FSCN) Human ELISA Kit
D3595 96 Tests

Fascin (FSCN) Human ELISA Kit

Sign In for Pricing
View Details
Rno-miR-3579 antagomir
HY-RI04416A-01 5 nmol

Rno-miR-3579 antagomir

Sign In for Pricing
View Details
Rno-miR-3579 antagomir
HY-RI04416A-02 20 nmol

Rno-miR-3579 antagomir

Sign In for Pricing
View Details
CYP3A43 Human Pre-designed siRNA Set A
HY-RS03472 1 Set

CYP3A43 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phospho-HDAC7 (S155) Antibody
CSB-PA030002-01 50 µg

Phospho-HDAC7 (S155) Antibody

Sign In for Pricing
View Details
Phospho-HDAC7 (S155) Antibody
CSB-PA030002-02 100 µg

Phospho-HDAC7 (S155) Antibody

Sign In for Pricing
View Details