Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECI2 Peptide - middle region

ECI2 Peptide - middle region

Product Specifications

Product Name Alternative

DRS1, PECI, ACBD2, DRS-1, HCA88, dJ1013A10.3

UniProt

O75521

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159482.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRPKKKNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIN2D Blocking Peptide
orb706520-01 1 mg

GRIN2D Blocking Peptide

Sign In for Pricing
View Details
GRIN2D Blocking Peptide
orb706520-02 5 mg

GRIN2D Blocking Peptide

Sign In for Pricing
View Details
ARMC7 Rabbit Polyclonal Antibody (FITC)
orb2087799 100 µL

ARMC7 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Proteoglycan 4 (PRG4) Bovine ELISA Kit
G4648 96 Tests

Proteoglycan 4 (PRG4) Bovine ELISA Kit

Sign In for Pricing
View Details
FITC Antibody (HRP)
orb430087 1 mL

FITC Antibody (HRP)

Sign In for Pricing
View Details
Duran Funnel With Short Stem 80mm Top Dia.
FUN10580 10 / PCK

Duran Funnel With Short Stem 80mm Top Dia.

Sign In for Pricing
View Details