ECI2 Peptide - N-terminal region
ECI2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DRS1, PECI, ACBD2, DRS-1, HCA88, dJ1013A10.3
UniProt
O75521
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001159482.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6152223-01 0.1 mL
DTNB (Dystrobrevin beta, DTN-B, Beta-dystrobrevin, MGC17163, MGC57126) (HRP)
Sign In for Pricing
View Details MBS6152223-02 5x 0.1 mL
DTNB (Dystrobrevin beta, DTN-B, Beta-dystrobrevin, MGC17163, MGC57126) (HRP)
Sign In for Pricing
View Details 
043237-FITC 200 µL
TRIM39, ID (TRIM39, RNF23, TFP, E3 ubiquitin-protein ligase TRIM39, RING finger protein 23, Testis-abundant finger protein, Tripartite motif-containing protein 39) (FITC) discontinued
Sign In for Pricing
View Details