Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECI2 Peptide - N-terminal region

ECI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DRS1, PECI, ACBD2, DRS-1, HCA88, dJ1013A10.3

UniProt

O75521

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159482.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDILT Protein, His Tag
KMH1531 50 µg

Recombinant Human PDILT Protein, His Tag

Sign In for Pricing
View Details
STAT3 Antibody
GWB-MX425B 50 µg

STAT3 Antibody

Sign In for Pricing
View Details
ELISA Kit For Ubiquitin-associated domain-containing protein 2
E6570h 96 Tests

ELISA Kit For Ubiquitin-associated domain-containing protein 2

Sign In for Pricing
View Details
ARHGEF6 Antibody
DF9865-01 100 µL

ARHGEF6 Antibody

Sign In for Pricing
View Details
ARHGEF6 Antibody
DF9865-02 200 µL

ARHGEF6 Antibody

Sign In for Pricing
View Details
CD117 Blocking Peptide
MBS823406-01 1 mg

CD117 Blocking Peptide

Sign In for Pricing
View Details