ECI2 Peptide - N-terminal region
ECI2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DRS1, PECI, ACBD2, DRS-1, HCA88, dJ1013A10.3
UniProt
O75521
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001159482.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MRASQKDFENSMNQVKLLKKDPGNEVKLKLYALYKQATEGPCNMPKPGVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A1379-12 10 mg
5-Amino-3- (1-naphthyl) -4-cyano-1-tert-butylpyrazole (5-Amino-1- (1,1-dimethylethyl) -3- (1-naphthalenyl) -1H-pyrazole-4-carbonitrile_x000B_5-Amino-1- (tert-butyyl) -3- (1-naphthalenyl) -1H-pyrazole-4-carbonitrile)
Sign In for Pricing
View Details 
TL314050 1 Kit
CDC2L6 (CDK19) Human shRNA Plasmid Kit (Locus ID 23097)
Sign In for Pricing
View Details 
DZ41080-FITC 200 µL/Vial
Anti-African malaria mosquito TEP1 Antibody-FITC Conjugate
Sign In for Pricing
View Details