What is the catalog number for ZPR1 Peptide - middle region?

The catalog number for ZPR1 Peptide - middle region is orb1999332.

What sizes are available for ZPR1 Peptide - middle region?

ZPR1 Peptide - middle region is available in the following size(s): 100 µg.

Is ZPR1 Peptide - middle region in stock?

ZPR1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ZPR1 Peptide - middle region

Product Specifications

Product Name Alternative

ZNF259

UniProt

O75312

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003895.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SI115689A 1 Each

Mouse Unc13c Pre-designed siRNA Set A

Sign In for Pricing

View Details

NBP2-54472G 0.1 mL

Mouse Monoclonal CDX2 Antibody (CDX2/1690) [DyLight 488]

Sign In for Pricing

View Details

20141176 3x 5 nmol

Fam83b siRNA Oligos set (Rat)

Sign In for Pricing

View Details

MBS2160107-01 96 Tests

Crystallin Lambda 1 (CRYl1) Magnetic Fluorescence Assay Kit

Sign In for Pricing

View Details

MBS2160107-02 5x 96 Tests

Crystallin Lambda 1 (CRYl1) Magnetic Fluorescence Assay Kit

Sign In for Pricing

View Details

MBS2160107-03 10x 96 Tests

Crystallin Lambda 1 (CRYl1) Magnetic Fluorescence Assay Kit

Sign In for Pricing

View Details