Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLGALT1 Peptide - middle region

COLGALT1 Peptide - middle region

Product Specifications

Product Name Alternative

GLT25D1, ColGalT 1

UniProt

Q5T4B2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078932.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLYHSVEWRPAEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOC Human Gene Knockout Kit (CRISPR)
KN421013 1 Kit

BOC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Asic2 activation kit by CRISPRa
GA200018 1 Kit

Mouse Asic2 activation kit by CRISPRa

Sign In for Pricing
View Details
6-SIMA phosphoramidite
6052-AAT 100 µmole

6-SIMA phosphoramidite

Sign In for Pricing
View Details
1,4-bis(7-Chloroquinolin-4-yl)piperazine
TRC-C327200-50MG 50 mg

1,4-bis(7-Chloroquinolin-4-yl)piperazine

Sign In for Pricing
View Details
GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody [Clone ID: OTI2E12]
CF812525 100 µg

GM CSF Receptor alpha (CSF2RA) Mouse Monoclonal Antibody [Clone ID: OTI2E12]

Sign In for Pricing
View Details
Human UBE2D4 activation kit by CRISPRa
GA109905 1 Kit

Human UBE2D4 activation kit by CRISPRa

Sign In for Pricing
View Details