Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLGALT1 Peptide - middle region

COLGALT1 Peptide - middle region

Product Specifications

Product Name Alternative

GLT25D1, ColGalT 1

UniProt

Q5T4B2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078932.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLYHSVEWRPAEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-
F-2201-2 2 mg

FITC Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details
Vmn2r62 Mouse Gene Knockout Kit (CRISPR)
KN519193 1 Kit

Vmn2r62 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospholipase A2 IIA (PLA2G2A) Rabbit Monoclonal Antibody [Clone ID: R09-4F9]
TA384991 100 µL

Phospholipase A2 IIA (PLA2G2A) Rabbit Monoclonal Antibody [Clone ID: R09-4F9]

Sign In for Pricing
View Details
Anti-Cytokeratin 8 Antibody [SU0338]
ET1608-32TR 20 µL

Anti-Cytokeratin 8 Antibody [SU0338]

Sign In for Pricing
View Details
(3beta)-7-Dehydro Cholesterol
TRC-D229455-1G 1 g

(3beta)-7-Dehydro Cholesterol

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS801976 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details