Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP2 Peptide - middle region

USP2 Peptide - middle region

Product Specifications

Product Name Alternative

USP9, UBP41

UniProt

O75604

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230688.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LGALS16 Protein, Untagged, E.coli-1mg
QP12561-1mg 1mg

Recombinant Human LGALS16 Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
Mouse Anti-Mouse CD45.1-PE/CY7
31-2072-0.1 0.1 mg

Mouse Anti-Mouse CD45.1-PE/CY7

Sign In for Pricing
View Details
ATXN10 Antibody - N-terminal region
ARP61891_P050-25UL 25 µL

ATXN10 Antibody - N-terminal region

Sign In for Pricing
View Details
PTK7 CRISPR/Cas9 KO Plasmid (h)
sc-403922 20 µg

PTK7 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
pDRIVE-SV40-hAlb
pdrive-sv40halb 20 µg

pDRIVE-SV40-hAlb

Sign In for Pricing
View Details
Zfp668 Rat siRNA Oligo Duplex (Locus ID 309002)
SR505468 1 Kit

Zfp668 Rat siRNA Oligo Duplex (Locus ID 309002)

Sign In for Pricing
View Details