Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP2 Peptide - middle region

USP2 Peptide - middle region

Product Specifications

Product Name Alternative

USP9, UBP41

UniProt

O75604

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230688.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Absent In Melanoma 2 (AIM2) ELISA Kit
RD-AIM2-Hu-01 96 Tests

Human Absent In Melanoma 2 (AIM2) ELISA Kit

Sign In for Pricing
View Details
Human Absent In Melanoma 2 (AIM2) ELISA Kit
RD-AIM2-Hu-02 48 Tests

Human Absent In Melanoma 2 (AIM2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Trypsin-3 (PRSS3), partial
RPC20201-01 20 µg

Recombinant Human Trypsin-3 (PRSS3), partial

Sign In for Pricing
View Details
Recombinant Human Trypsin-3 (PRSS3), partial
RPC20201-02 100 µg

Recombinant Human Trypsin-3 (PRSS3), partial

Sign In for Pricing
View Details
Recombinant Human Trypsin-3 (PRSS3), partial
RPC20201-03 1 mg

Recombinant Human Trypsin-3 (PRSS3), partial

Sign In for Pricing
View Details
AMPαS – Solution, S pack
JBS-NU-1161S 100 µL

AMPαS – Solution, S pack

Sign In for Pricing
View Details