Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP2 Peptide - middle region

USP2 Peptide - middle region

Product Specifications

Product Name Alternative

USP9, UBP41

UniProt

O75604

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230688.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP-2 Recombinant Rabbit monoclonal Antibody
HA751405 100 µL

MMP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CNOT4 (NM_001008225) Human Over-expression Lysate
LC423402 20 µg

CNOT4 (NM_001008225) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-EL-M0646-01 24 Tests

Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-EL-M0646-02 48 Tests

Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-EL-M0646-03 96 Tests

Mouse TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details
4-O-Benzyl Tyrosol Alpha-Acetate 3-Aldehyde
TRC-B316400-1G 1 g

4-O-Benzyl Tyrosol Alpha-Acetate 3-Aldehyde

Sign In for Pricing
View Details