Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP2 Peptide - middle region

USP2 Peptide - middle region

Product Specifications

Product Name Alternative

USP9, UBP41

UniProt

O75604

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230688.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mannose Phosphate Isomerase (MPI) (NM_002435) Human Over-expression Lysate
LC419324 20 µg

Mannose Phosphate Isomerase (MPI) (NM_002435) Human Over-expression Lysate

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-2440-01 50 μL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-2440-02 100 µL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-2440-03 1 mL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details
CRBN Human Gene Knockout Kit (CRISPR)
KN209794 1 Kit

CRBN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FBP1 (NM_001127628) Human Over-expression Lysate
LC426827 20 µg

FBP1 (NM_001127628) Human Over-expression Lysate

Sign In for Pricing
View Details