Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAT1 Peptide - middle region

GNAT1 Peptide - middle region

Product Specifications

Product Name Alternative

GBT1, GNATR, CSNB1G, CSNBAD3

UniProt

P11488

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000163.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKAHLSICFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-Granzyme B antibody (Rabbit mAb)
GB150015-100 100 μL

Recombinant Anti-Granzyme B antibody (Rabbit mAb)

Sign In for Pricing
View Details
C18orf10 Adenovirus (Human)
14021051 1.0 mL

C18orf10 Adenovirus (Human)

Sign In for Pricing
View Details
Dodecanylamine Liposome
MPL0963K Each

Dodecanylamine Liposome

Sign In for Pricing
View Details
CASK Rabbit Polyclonal Antibody (BF555)
orb2545338 100 µL

CASK Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Mouse Anti-Human Ig kappa chain - AP
BS21419-01 100 µL

Mouse Anti-Human Ig kappa chain - AP

Sign In for Pricing
View Details
Mouse Anti-Human Ig kappa chain - AP
BS21419-02 500 µL

Mouse Anti-Human Ig kappa chain - AP

Sign In for Pricing
View Details