Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAT1 Peptide - middle region

GNAT1 Peptide - middle region

Product Specifications

Product Name Alternative

GBT1, GNATR, CSNB1G, CSNBAD3

UniProt

P11488

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000163.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKAHLSICFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 2700049A03Rik shRNA (UAS) - Lentiviral mouse 2700049A03Rik shRNA (UAS, iRFP) (100)
GTR15220527 1 Vial

Lentiviral mouse 2700049A03Rik shRNA (UAS) - Lentiviral mouse 2700049A03Rik shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Carbanilic acid, m-heptyloxy-, 2- (dimethylamino) ethyl ester, hydrochloride
orb1986301-01 100 mg

Carbanilic acid, m-heptyloxy-, 2- (dimethylamino) ethyl ester, hydrochloride

Sign In for Pricing
View Details
Carbanilic acid, m-heptyloxy-, 2- (dimethylamino) ethyl ester, hydrochloride
orb1986301-02 500 mg

Carbanilic acid, m-heptyloxy-, 2- (dimethylamino) ethyl ester, hydrochloride

Sign In for Pricing
View Details
Ppbp ORF Vector (Rat) (pORF)
ORF073858 1.0 µg DNA

Ppbp ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Monoclonal Antibody to Granzyme M (GZMM)
TRV-0033611-01 20 µL

Monoclonal Antibody to Granzyme M (GZMM)

Sign In for Pricing
View Details
Monoclonal Antibody to Granzyme M (GZMM)
TRV-0033611-02 100 µL

Monoclonal Antibody to Granzyme M (GZMM)

Sign In for Pricing
View Details