Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAT1 Peptide - middle region

GNAT1 Peptide - middle region

Product Specifications

Product Name Alternative

GBT1, GNATR, CSNB1G, CSNBAD3

UniProt

P11488

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000163.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a (C1A/711), 1mg/mL
BNUM0711-50 1x 50 µL

CD1a (C1A/711), 1mg/mL

Sign In for Pricing
View Details
Recombinant Inhibin beta A Antibody
RC-5135-01 50 μL

Recombinant Inhibin beta A Antibody

Sign In for Pricing
View Details
Recombinant Inhibin beta A Antibody
RC-5135-02 100 µL

Recombinant Inhibin beta A Antibody

Sign In for Pricing
View Details
Recombinant Inhibin beta A Antibody
RC-5135-03 1 mL

Recombinant Inhibin beta A Antibody

Sign In for Pricing
View Details
ILK Polyclonal Antibody
E-AB-10396-01 20 µL

ILK Polyclonal Antibody

Sign In for Pricing
View Details
ILK Polyclonal Antibody
E-AB-10396-02 60 µL

ILK Polyclonal Antibody

Sign In for Pricing
View Details