What is the catalog number for CKB Peptide - middle region?

The catalog number for CKB Peptide - middle region is orb1999313.

What sizes are available for CKB Peptide - middle region?

CKB Peptide - middle region is available in the following size(s): 100 µg.

Is CKB Peptide - middle region in stock?

CKB Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CKB Peptide - middle region

Product Specifications

Product Name Alternative

BCK, B-CK, CKBB, HEL-211, HEL-S-29

UniProt

P12277

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001814.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-415969 20 µg

C4orf40 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing

View Details

011258 1 mg

(R, S) -Equol 7-β-D-Glucuronide Methyl Ester

Sign In for Pricing

View Details

orb2920965-01 20 µg

Recombinant Lactobacillus plantarum Lipoprotein signal peptidase (lspA)

Sign In for Pricing

View Details

orb2920965-02 100 µg

Recombinant Lactobacillus plantarum Lipoprotein signal peptidase (lspA)

Sign In for Pricing

View Details

MBS8305053-01 0.01 mg

Recombinant Human Mesothelin Protein

Sign In for Pricing

View Details

MBS8305053-02 0.05 mg

Recombinant Human Mesothelin Protein

Sign In for Pricing

View Details