CKB Peptide - middle region
CKB Peptide - middle region
Product Specifications
Product Name Alternative
BCK, B-CK, CKBB, HEL-211, HEL-S-29
UniProt
P12277
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001814.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15118505 1 Vial
Lentiviral mouse Asb18 shRNA (UAS) - Lentiviral mouse Asb18 shRNA (UAS) (25)
Sign In for Pricing
View Details 
MBS1121533-01 0.02 mg (E-Coli)
Recombinant Escherichia coli Sulfate adenylyltransferase subunit 1 (cysN)
Sign In for Pricing
View Details MBS1121533-02 0.02 mg (Yeast)
Recombinant Escherichia coli Sulfate adenylyltransferase subunit 1 (cysN)
Sign In for Pricing
View Details MBS1121533-03 0.1 mg (E-Coli)
Recombinant Escherichia coli Sulfate adenylyltransferase subunit 1 (cysN)
Sign In for Pricing
View Details MBS1121533-04 0.1 mg (Yeast)
Recombinant Escherichia coli Sulfate adenylyltransferase subunit 1 (cysN)
Sign In for Pricing
View Details