What is the catalog number for CAMKK2 Peptide - middle region?

The catalog number for CAMKK2 Peptide - middle region is orb1999312.

What sizes are available for CAMKK2 Peptide - middle region?

CAMKK2 Peptide - middle region is available in the following size(s): 100 µg.

Is CAMKK2 Peptide - middle region in stock?

CAMKK2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CAMKK2 Peptide - middle region

Product Specifications

Product Name Alternative

CAMKK, CAMKKB

UniProt

Q96RR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257414.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RR209456L3 10 µg

Gpn3 (NM_201991) Rat Tagged Lenti ORF Clone

Sign In for Pricing

View Details

SR418811 1 Kit

Rpap3 Mouse siRNA Oligo Duplex (Locus ID 71919)

Sign In for Pricing

View Details

LKU601117 96 Tests

Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) Magnetic Luminex Assay Kit

Sign In for Pricing

View Details

MBS584139-01 0.1 mg

Neutrophils, Mouse, mAb NIMP-R14, FITC

Sign In for Pricing

View Details

MBS584139-02 5x 0.1 mg

Neutrophils, Mouse, mAb NIMP-R14, FITC

Sign In for Pricing

View Details

E28M1276 100 µL

ERK1/2 (4R7) Rabbit Monoclonal Antibody

Sign In for Pricing

View Details