Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMKK2 Peptide - middle region

CAMKK2 Peptide - middle region

Product Specifications

Product Name Alternative

CAMKK, CAMKKB

UniProt

Q96RR4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257414.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVEVTEEEVENSVKHIPSLATVILVKTMIRKRSFGNPFEGSRREERSLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Jo1/HRS ELISA Kit
SL2803Hu-01 48 Tests

Human Jo1/HRS ELISA Kit

Sign In for Pricing
View Details
Human Jo1/HRS ELISA Kit
SL2803Hu-02 96 Tests

Human Jo1/HRS ELISA Kit

Sign In for Pricing
View Details
Sytl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46011114 3x 1.0 µg

Sytl1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS109286-01 48 Well

Human Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS109286-02 96 Well

Human Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Sign In for Pricing
View Details
Human Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit
MBS109286-03 5x 96 Well

Human Potassium/Sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) ELISA Kit

Sign In for Pricing
View Details