Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX5B Peptide - middle region

COX5B Peptide - middle region

Product Specifications

Product Name Alternative

COXVB

UniProt

P10606

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001853.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2AX Antibody
KC-1825-01 50 μL

Histone H2AX Antibody

Sign In for Pricing
View Details
Histone H2AX Antibody
KC-1825-02 100 µL

Histone H2AX Antibody

Sign In for Pricing
View Details
Histone H2AX Antibody
KC-1825-03 1 mL

Histone H2AX Antibody

Sign In for Pricing
View Details
AJUBA Human Gene Knockout Kit (CRISPR)
KN205482 1 Kit

AJUBA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P34 / cdk1 (CDK1/873), CF640R conjugate, 0.1mg/mL
BNC400873-500 1x 500 µL

P34 / cdk1 (CDK1/873), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein E/ApoE protein (His tag)
PDMH100121-01 20 µg

Recombinant Human Apolipoprotein E/ApoE protein (His tag)

Sign In for Pricing
View Details