Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX5B Peptide - middle region

COX5B Peptide - middle region

Product Specifications

Product Name Alternative

COXVB

UniProt

P10606

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001853.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADH1B activation kit by CRISPRa
GA100085 1 Kit

Human ADH1B activation kit by CRISPRa

Sign In for Pricing
View Details
Human PH domain containing family G member 7 (PLEKHG7) activation kit by CRISPRa
GA118438 1 Kit

Human PH domain containing family G member 7 (PLEKHG7) activation kit by CRISPRa

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF594 conjugate, 0.1mg/mL
BNC942052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase 1 (CASP1) Rabbit Polyclonal Antibody
AP06610PU-N 100 µg

Caspase 1 (CASP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cinnamylamine Hydrochloride
TRC-C442090-500MG 500 mg

Cinnamylamine Hydrochloride

Sign In for Pricing
View Details
GC1q R Recombinant Mouse Monoclonal Antibody [A8F5-R]
HA601198 100 µL

GC1q R Recombinant Mouse Monoclonal Antibody [A8F5-R]

Sign In for Pricing
View Details