Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM2 Peptide - middle region

IFITM2 Peptide - middle region

Product Specifications

Product Name Alternative

1-8D, DSPA2c

UniProt

Q01629

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006426.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF488A conjugate, 0.1mg/mL
BNC881297-500 1x 500 µL

HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AM4-64
#70025 1x 1 mg

AM4-64

Sign In for Pricing
View Details
Recombinant NDUFB11 Antibody
RC-5255-01 50 μL

Recombinant NDUFB11 Antibody

Sign In for Pricing
View Details
Recombinant NDUFB11 Antibody
RC-5255-02 100 µL

Recombinant NDUFB11 Antibody

Sign In for Pricing
View Details
Recombinant NDUFB11 Antibody
RC-5255-03 1 mL

Recombinant NDUFB11 Antibody

Sign In for Pricing
View Details
MARK3 Antibody
8C10490-AAT 50 µg

MARK3 Antibody

Sign In for Pricing
View Details