What is the catalog number for IFITM2 Peptide - middle region?

The catalog number for IFITM2 Peptide - middle region is orb1999307.

What sizes are available for IFITM2 Peptide - middle region?

IFITM2 Peptide - middle region is available in the following size(s): 100 µg.

Is IFITM2 Peptide - middle region in stock?

IFITM2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

IFITM2 Peptide - middle region

Product Specifications

Product Name Alternative

1-8D, DSPA2c

UniProt

Q01629

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006426.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx982434-01 150 µg

Mouse CCHCR1 shRNA Plasmid

Sign In for Pricing

View Details

abx982434-02 300 µg

Mouse CCHCR1 shRNA Plasmid

Sign In for Pricing

View Details

NB120-8346R 0.2 mL

Mouse Monoclonal Pappalysin-1/PAPP-A Antibody (10E1) [DyLight 550]

Sign In for Pricing

View Details

EK10863 48 Tests

Chicken Decorin (DCN) ELISA Kit

Sign In for Pricing

View Details

RR210245 10 µg

Ago2 (NM_021597) Rat Tagged ORF Clone

Sign In for Pricing

View Details

sc-422356-ACT 20 µg

Brn-3c CRISPR Activation Plasmid (m)

Sign In for Pricing

View Details