Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFITM2 Peptide - middle region

IFITM2 Peptide - middle region

Product Specifications

Product Name Alternative

1-8D, DSPA2c

UniProt

Q01629

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006426.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Glucuronidase, Beta ELISA Kit
MBS739752-01 48 Well

Chicken Glucuronidase, Beta ELISA Kit

Sign In for Pricing
View Details
Chicken Glucuronidase, Beta ELISA Kit
MBS739752-02 96 Well

Chicken Glucuronidase, Beta ELISA Kit

Sign In for Pricing
View Details
Chicken Glucuronidase, Beta ELISA Kit
MBS739752-03 5x 96 Well

Chicken Glucuronidase, Beta ELISA Kit

Sign In for Pricing
View Details
Chicken Glucuronidase, Beta ELISA Kit
MBS739752-04 10x 96 Well

Chicken Glucuronidase, Beta ELISA Kit

Sign In for Pricing
View Details
Research Grade Pelgifatamab
MBS1563786-01 0.1 mg

Research Grade Pelgifatamab

Sign In for Pricing
View Details
Research Grade Pelgifatamab
MBS1563786-02 1 mg

Research Grade Pelgifatamab

Sign In for Pricing
View Details