Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS10 Peptide - middle region

RPS10 Peptide - middle region

Product Specifications

Product Name Alternative

S10, DBA9

UniProt

Q9NQ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11d (ITGAD) Human Gene Knockout Kit (CRISPR)
KN424758 1 Kit

CD11d (ITGAD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VMO1 (NM_001144940) Human Recombinant Protein
TP720495L 500 µg

VMO1 (NM_001144940) Human Recombinant Protein

Sign In for Pricing
View Details
But-3-en-1-yl (4-Hydroxybutyl) Terephthalate
TRC-B849205-25MG 25 mg

But-3-en-1-yl (4-Hydroxybutyl) Terephthalate

Sign In for Pricing
View Details
Human TSP-4 Antibody Pair Set
E-KAB-0680 50 µL & 100 µg

Human TSP-4 Antibody Pair Set

Sign In for Pricing
View Details
NF2 Human Gene Knockout Kit (CRISPR)
KN400690 1 Kit

NF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® AC RAM
TH30902.011014023.1G 1 g

TentaGel® AC RAM

Sign In for Pricing
View Details