Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS10 Peptide - middle region

RPS10 Peptide - middle region

Product Specifications

Product Name Alternative

S10, DBA9

UniProt

Q9NQ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Fluorimetric Biotin Quantitation Kit
5538-AAT 100 Tests

Amplite® Fluorimetric Biotin Quantitation Kit

Sign In for Pricing
View Details
Anilopam
TRC-A672600-5MG 5 mg

Anilopam

Sign In for Pricing
View Details
Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)
KN209151 1 Kit

Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS508184 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
3-Chloro-5-fluorobenzoic acid
TRC-C584780-250MG 250 mg

3-Chloro-5-fluorobenzoic acid

Sign In for Pricing
View Details
H/K/N-Ras (N-term) Rabbit Polyclonal Antibody
AP31149PU-N 50 µL

H/K/N-Ras (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details