Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS10 Peptide - middle region

RPS10 Peptide - middle region

Product Specifications

Product Name Alternative

S10, DBA9

UniProt

Q9NQ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF9 (N-term) Rabbit Polyclonal Antibody
AP51661PU-N 400 µL

FGF9 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C8orf55 (THEM6) Human Gene Knockout Kit (CRISPR)
KN401709 1 Kit

C8orf55 (THEM6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TGFB1 Antibody
KC-3080-01 50 μL

TGFB1 Antibody

Sign In for Pricing
View Details
TGFB1 Antibody
KC-3080-02 100 µL

TGFB1 Antibody

Sign In for Pricing
View Details
TGFB1 Antibody
KC-3080-03 1 mL

TGFB1 Antibody

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2423), CF640R conjugate, 0.1mg/mL
BNC402423-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2423), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details