Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS10 Peptide - middle region

RPS10 Peptide - middle region

Product Specifications

Product Name Alternative

S10, DBA9

UniProt

Q9NQ39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit
RDR-KLF2-Hu-01 96 Tests

Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit

Sign In for Pricing
View Details
Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit
RDR-KLF2-Hu-02 48 Tests

Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit

Sign In for Pricing
View Details
TAF4 Antibody
8C10018-AAT 50 µg

TAF4 Antibody

Sign In for Pricing
View Details
Human TRAPPC2B activation kit by CRISPRa
GA107252 1 Kit

Human TRAPPC2B activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS707413 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
MEPCE antibody
FNab05126 100 µg

MEPCE antibody

Sign In for Pricing
View Details