What is the catalog number for DLGAP4 Peptide - middle region?

The catalog number for DLGAP4 Peptide - middle region is orb1999304.

What sizes are available for DLGAP4 Peptide - middle region?

DLGAP4 Peptide - middle region is available in the following size(s): 100 µg.

Is DLGAP4 Peptide - middle region in stock?

DLGAP4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

DLGAP4 Peptide - middle region

Product Specifications

Product Name Alternative

DAP4, DLP4, DAP-4, SAPAP4, SAPAP-4

UniProt

Q9Y2H0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035951.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

abx128539-01 100 µL

Osteonectin (SPARC) Antibody

Sign In for Pricing

View Details

abx128539-02 200 µL

Osteonectin (SPARC) Antibody

Sign In for Pricing

View Details

abx128539-03 1 mL

Osteonectin (SPARC) Antibody

Sign In for Pricing

View Details

NBP2-71407APCCY7 0.1 mL

Mouse Monoclonal DOK2 Antibody (OTI1A4) [Allophycocyanin/Cy7]

Sign In for Pricing

View Details

bs-10743R-APC-01 20 µL

Caspase-1 p20 Polyclonal Antibody, APC Conjugated

Sign In for Pricing

View Details

bs-10743R-APC-02 100 µL

Caspase-1 p20 Polyclonal Antibody, APC Conjugated

Sign In for Pricing

View Details