Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO4 Peptide - middle region

IPO4 Peptide - middle region

Product Specifications

Product Name Alternative

Imp4

UniProt

Q8TEX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078934.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAEPPPGQLDPEDQDSEEEELEIELMGETPKHFAVQVVDMLALHLPPEKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Mouse CD170 Antibody[S17007L]
AN00629D-01 50 Tests

PE Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
PE Anti-Mouse CD170 Antibody[S17007L]
AN00629D-02 100 Tests

PE Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
PE Anti-Mouse CD170 Antibody[S17007L]
AN00629D-03 2x 100 Tests

PE Anti-Mouse CD170 Antibody[S17007L]

Sign In for Pricing
View Details
Creatine Kinase-BB (CK-BB) (CKBB/1268), CF405S conjugate, 0.1mg/mL
BNC041268-100 1x 100 µL

Creatine Kinase-BB (CK-BB) (CKBB/1268), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TPK1 Protein (His Tag)
PKSH033104-01 10 µg

Recombinant Human TPK1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TPK1 Protein (His Tag)
PKSH033104-02 50 µg

Recombinant Human TPK1 Protein (His Tag)

Sign In for Pricing
View Details