Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO4 Peptide - middle region

IPO4 Peptide - middle region

Product Specifications

Product Name Alternative

Imp4

UniProt

Q8TEX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078934.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAEPPPGQLDPEDQDSEEEELEIELMGETPKHFAVQVVDMLALHLPPEKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGLN2 Mouse Monoclonal Antibody [Clone ID: OTI5E11]
CF808685 100 µg

EGLN2 Mouse Monoclonal Antibody [Clone ID: OTI5E11]

Sign In for Pricing
View Details
BEAN1 Human Gene Knockout Kit (CRISPR)
KN427848 1 Kit

BEAN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RNase H2 subunit C (RNASEH2C) activation kit by CRISPRa
GA113396 1 Kit

Human RNase H2 subunit C (RNASEH2C) activation kit by CRISPRa

Sign In for Pricing
View Details
HLA-DRB (LN-3 + HLA-DRB/1067), Biotin conjugate, 0.1mg/mL
BNCB1208-100 1x 100 µL

HLA-DRB (LN-3 + HLA-DRB/1067), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carhsp1 (NM_025821) Mouse Tagged ORF Clone
MG201012 10 µg

Carhsp1 (NM_025821) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human ITPase/ITPA Protein (His Tag)
PKSH032588-01 10 µg

Recombinant Human ITPase/ITPA Protein (His Tag)

Sign In for Pricing
View Details