Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO4 Peptide - middle region

IPO4 Peptide - middle region

Product Specifications

Product Name Alternative

Imp4

UniProt

Q8TEX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078934.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIRQRLLPPLLQIVCKGLEDPSQVVRNAALFALGQFSENLQPHISSYSRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synuclein alpha (pY125) Antibody
abx119501-01 10 µg

Synuclein alpha (pY125) Antibody

Sign In for Pricing
View Details
Synuclein alpha (pY125) Antibody
abx119501-02 100 µg

Synuclein alpha (pY125) Antibody

Sign In for Pricing
View Details
Synuclein alpha (pY125) Antibody
abx119501-03 200 µg

Synuclein alpha (pY125) Antibody

Sign In for Pricing
View Details
Synuclein alpha (pY125) Antibody
abx119501-04 300 µg

Synuclein alpha (pY125) Antibody

Sign In for Pricing
View Details
Synuclein alpha (pY125) Antibody
abx119501-05 1 mg

Synuclein alpha (pY125) Antibody

Sign In for Pricing
View Details
CARNS1 Protein Vector (Mouse) (pPM-C-His)
PV161605 500 ng

CARNS1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details