Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO4 Peptide - middle region

IPO4 Peptide - middle region

Product Specifications

Product Name Alternative

Imp4

UniProt

Q8TEX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_078934.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIRQRLLPPLLQIVCKGLEDPSQVVRNAALFALGQFSENLQPHISSYSRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human soluble cluster of differentiation 163 (sCD163) Elisa Kit
EK710585 96 Well

Human soluble cluster of differentiation 163 (sCD163) Elisa Kit

Sign In for Pricing
View Details
Ramosetron Impurity 16
RM-R131916-01 10 mg

Ramosetron Impurity 16

Sign In for Pricing
View Details
Ramosetron Impurity 16
RM-R131916-02 25 mg

Ramosetron Impurity 16

Sign In for Pricing
View Details
Ramosetron Impurity 16
RM-R131916-03 50 mg

Ramosetron Impurity 16

Sign In for Pricing
View Details
Ramosetron Impurity 16
RM-R131916-04 100 mg

Ramosetron Impurity 16

Sign In for Pricing
View Details
Anti-Occludin/Ocln Antibody Picoband®, HRP Conjugate
A01246-3-HRP 100 µg/Vial

Anti-Occludin/Ocln Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details