Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP2 Peptide - middle region

PPFIBP2 Peptide - middle region

Product Specifications

Product Name Alternative

Cclp1

UniProt

Q8ND30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQLHHLSIKCAIHVLHVNKFNPHCLHRRPADESNLSPSEVVQWSNHRVME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sfi1 (NM_030207) Mouse Tagged ORF Clone Lentiviral Particle
MR218042L3V 200 µL

Sfi1 (NM_030207) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit (non-immune) Serum IgM, purified
20009-2-1 0.1 mg

Rabbit (non-immune) Serum IgM, purified

Sign In for Pricing
View Details
SPF30 (D-11) Alexa Fluor® 594
sc-398259 AF594 200 µg/mL

SPF30 (D-11) Alexa Fluor® 594

Sign In for Pricing
View Details
RGR Polyclonal Antibody
RD84806A-01 60 μL

RGR Polyclonal Antibody

Sign In for Pricing
View Details
RGR Polyclonal Antibody
RD84806A-02 120 μL

RGR Polyclonal Antibody

Sign In for Pricing
View Details
RGR Polyclonal Antibody
RD84806A-03 200 µL

RGR Polyclonal Antibody

Sign In for Pricing
View Details