Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPFIBP2 Peptide - middle region

PPFIBP2 Peptide - middle region

Product Specifications

Product Name Alternative

Cclp1

UniProt

Q8ND30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQLHHLSIKCAIHVLHVNKFNPHCLHRRPADESNLSPSEVVQWSNHRVME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Ala-Ala-Ala-Ala-Ala-Ala-OH
4010634.1 1 g

H-Ala-Ala-Ala-Ala-Ala-Ala-OH

Sign In for Pricing
View Details
Cdc14 (CDC14A, Dual specificity protein phosphatase CDC14A, CDC14 cell division cycle 14 homolog A) (AP) discontinued
033564-AP 200 µL

Cdc14 (CDC14A, Dual specificity protein phosphatase CDC14A, CDC14 cell division cycle 14 homolog A) (AP) discontinued

Sign In for Pricing
View Details
CANX Conjugated Antibody
orb1621723 100 µL

CANX Conjugated Antibody

Sign In for Pricing
View Details
Nt5c3l (BC015307) Mouse Tagged ORF Clone
MR203318 10 µg

Nt5c3l (BC015307) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human OR52N2 Knockout A549 cell line
GTR15403447 1 Vial

Human OR52N2 Knockout A549 cell line

Sign In for Pricing
View Details