Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK2 Peptide - middle region

HK2 Peptide - middle region

Product Specifications

Product Name Alternative

HKII, HXK2

UniProt

P52789

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000180.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNLRB1 Polyclonal Antibody
A51253-100 100 µL

DYNLRB1 Polyclonal Antibody

Sign In for Pricing
View Details
8-Hydroxyquinoline sulfate
73536449-100g 100 g

8-Hydroxyquinoline sulfate

Sign In for Pricing
View Details
hsa-miR-4477a miRNA Antagomir
MNH02357 2x 5.0 nmol

hsa-miR-4477a miRNA Antagomir

Sign In for Pricing
View Details
CTDSPL CRISPRa sgRNA lentivector (set of three targets)(Human)
17051121 3x 1.0µg DNA

CTDSPL CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
c-Raf (Ab-296) Antibody
MBS8509546-01 0.1 mg

c-Raf (Ab-296) Antibody

Sign In for Pricing
View Details
c-Raf (Ab-296) Antibody
MBS8509546-02 0.1 mL (AF635)

c-Raf (Ab-296) Antibody

Sign In for Pricing
View Details