Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK2 Peptide - middle region

HK2 Peptide - middle region

Product Specifications

Product Name Alternative

HKII, HXK2

UniProt

P52789

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000180.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6G Rabbit pAb
E45R23763N 50 ul

PDE6G Rabbit pAb

Sign In for Pricing
View Details
Olfr1499 Recombinant Protein (Mouse)
RP157145 100 µg

Olfr1499 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CYP714A2 Antibody
orb785544 2 mg

CYP714A2 Antibody

Sign In for Pricing
View Details
KLRA1 Peptide
orb1232872 0.05 mg

KLRA1 Peptide

Sign In for Pricing
View Details
ITGB1BP2 3'UTR Lenti-reporter-Luc Vector
25167081 1.0 µg

ITGB1BP2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
C4BPA (NM_000715) Human Over-expression Lysate
LH03051V 100 µg

C4BPA (NM_000715) Human Over-expression Lysate

Sign In for Pricing
View Details