Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECT2 Peptide - middle region

ECT2 Peptide - middle region

Product Specifications

Product Name Alternative

ARHGEF31

UniProt

Q9H8V3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001245244.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-IL-8 Antibody
YLD4345-01 50 µL

Rabbit anti-IL-8 Antibody

Sign In for Pricing
View Details
Rabbit anti-IL-8 Antibody
YLD4345-02 100 µL

Rabbit anti-IL-8 Antibody

Sign In for Pricing
View Details
MAGEL2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1257003 1.0 µg DNA

MAGEL2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Dopachrome tautomerase (DT) Human ELISA Kit
11067 96 Tests

Dopachrome tautomerase (DT) Human ELISA Kit

Sign In for Pricing
View Details
Mouse CD200R Antibody (RPE)
GWB-D5F7DB 100 Tests

Mouse CD200R Antibody (RPE)

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans pbs-3 Protein (aa 1-204)
VAng-Ly3585-50gEcoli 50 µg (E. coli)

Recombinant Caenorhabditis Elegans pbs-3 Protein (aa 1-204)

Sign In for Pricing
View Details