Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECT2 Peptide - middle region

ECT2 Peptide - middle region

Product Specifications

Product Name Alternative

ARHGEF31

UniProt

Q9H8V3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001245244.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LL-37 (37-1)
4099710.0500 0.5 mg

LL-37 (37-1)

Sign In for Pricing
View Details
METAP1D sgRNA CRISPR Lentivector (Human) (Target 1)
K2782802 1.0 µg DNA

METAP1D sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ASS1P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV757661 1.0 µg DNA

ASS1P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Goat Anti-Human IgG gamma chain - Alexa Fluor 488
E38A3205 100 µL

Goat Anti-Human IgG gamma chain - Alexa Fluor 488

Sign In for Pricing
View Details
Equine Skin Total protein
ET-101 1 mg

Equine Skin Total protein

Sign In for Pricing
View Details
Lentiviral human KCNA7 shRNA (UAS) - Lentiviral human KCNA7 shRNA (UAS, iRFP) (100)
GTR15084495 1 Vial

Lentiviral human KCNA7 shRNA (UAS) - Lentiviral human KCNA7 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details