Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI2 Peptide - middle region

GNAI2 Peptide - middle region

Product Specifications

Product Name Alternative

GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1

UniProt

P04899

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159897.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human START domain containing 7 Protein - (Dry Ice)
H00056910-P01-10ug 10 µg

Recombinant Human START domain containing 7 Protein - (Dry Ice)

Sign In for Pricing
View Details
Rat B9d2 Pre-designed siRNA Set A
SI201274A 1 Each

Rat B9d2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Hu CD15 APC
MBS1802503-01 100 Tests

Anti-Hu CD15 APC

Sign In for Pricing
View Details
Anti-Hu CD15 APC
MBS1802503-02 5x 100 Tests

Anti-Hu CD15 APC

Sign In for Pricing
View Details
IGKV2-19 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV764931 1.0 µg DNA

IGKV2-19 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PRR4 Human Over-expression Lysate
orb1344146 100 µg

PRR4 Human Over-expression Lysate

Sign In for Pricing
View Details