Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAI2 Peptide - middle region

GNAI2 Peptide - middle region

Product Specifications

Product Name Alternative

GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1

UniProt

P04899

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159897.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARA Recombinant Antibody, PerCP Conjugated
bsm-62621R-PerCP 100 µL

SARA Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
EPH receptor A4 Rabbit Polyclonal Antibody (BF555)
orb2487940 100 µL

EPH receptor A4 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
ACA11 Rabbit Polyclonal Antibody (Cy3)
orb982909 100 µL

ACA11 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mouse Monoclonal FOXB1 Antibody (PCRP-FOXB1-1B7) [Alexa Fluor 350]
NBP3-14021AF350 0.1 mL

Mouse Monoclonal FOXB1 Antibody (PCRP-FOXB1-1B7) [Alexa Fluor 350]

Sign In for Pricing
View Details
Olfr438 siRNA (m)
sc-150835 10 µM

Olfr438 siRNA (m)

Sign In for Pricing
View Details
Gamma-Synuclein Rabbit pAb
A14492-01 20 µL

Gamma-Synuclein Rabbit pAb

Sign In for Pricing
View Details